Talk:Protein secondary structure

	This article is within the scope of WikiProject Molecular Biology, a collaborative effort to improve the coverage of Molecular Biology on Wikipedia. If you would like to participate, please visit the project page, where you can join the discussion and see a list of open tasks.Molecular BiologyWikipedia:WikiProject Molecular BiologyTemplate:WikiProject Molecular BiologyMolecular Biology articles
High	This article has been rated as High-importance on the importance scale.
	This article is supported by the Molecular and Cell Biology task force (assessed as High-importance).

Too complex

Introduction too detailed for the layman to understandsdfghjkl the basic concept of secondary structure of proteins. Contains too much information that could be elaborated upon further in the body.

—Preceding unsigned comment added by 66.253.133.106 (talk) 02:43, 24 March 2008 (UTC)[reply]

Examples of secondary structures

Deleted this as example of secondary structure:

such as the DNA "double helix."

since this seems like an example of quaternary structure, since it's 2 molecules. Anyway, RNA secondary structure is much more prominent.

Zashaw 04:34, 18 Feb 2004 (UTC)

Prediction

I wanted to discuss this sentence:

While the prediction of protein secondary strcture is relativly straightforward, predicting RNA secondary structure is much harder.

I didn't think that protein secondary structure prediction was so easy (very likely just due to ignorance). Could someone name a program or citation or something that shows how this is easy? Thanks.

Zashaw 22:16, 18 Feb 2004 (UTC)

Amino acid propensities

Want to add a section about amino acid propensities in secondary structure! --Dan|^(talk) 18:10, 9 March 2006 (UTC)[reply]

Aren't beta sheets tertiary structure?

Is it not the case that beta strands are secondary structure but the beta sheets they form are tertiary structure?

Many textbooks do not recognise this, but this article should, assuming it's true.

Ben (talk) 14:56, 7 March 2009 (UTC)[reply]

List of secondary structures?

I was just popping in here to look up something basic (the claim that there are secondary structures other than alpha helix and beta sheets), and was a bit disappointed to notice that there wasn't a simple list of secondary structures. It should be fairly simple to add, and would add utility to the page. Mokele (talk) 13:48, 22 May 2009 (UTC)[reply]

Beta strand vs. Beta sheet

I endorse Ben's view about using beta strand (and not beta sheet) to exemplify the most common elements of secondary structure. Using beta sheets would be against the article's own definition of secondary structure ("the general three-dimensional form of local segments of biopolymers"). Beta sheets can are formed by different segments of proteins which can be very distant in the sequence, therefore it is tertiary structure, not secondary structure. While I understand why this confusion happens (one could not expect a single strand to exist by itself), it is important to make this distinction, because otherwise the definition and the example would be in conflict. — Preceding unsigned comment added by 150.164.24.242 (talk) 12:22, 9 September 2014 (UTC)[reply]

MAPD-2

MKFFTLLAALMALFAICNNFSMVSASRDSRPVQPRVQPPPPPPKQKPSIYDTPIRRPGGQKTMYA — Preceding unsigned comment added by 2001:DA8:B005:7070:74FC:AADD:E7D4:46BF (talk) 02:14, 18 September 2015 (UTC)[reply]

MDAP-2

MKFFTLLAALMALFAICNNFSMVSASRDSRPVQPRVQPPPPPPKQKPSIYDTPIRRPGGQKTMYA — Preceding unsigned comment added by 2001:DA8:B005:7070:74FC:AADD:E7D4:46BF (talk) 02:15, 18 September 2015 (UTC)[reply]